PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV20180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ZF-HD
Protein Properties Length: 259aa    MW: 28359.9 Da    PI: 9.0781
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV20180.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.98.7e-3252107359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++ Y+eClkNhAas+Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR++++ 
   KZV20180.1  52 RFSYRECLKNHAASIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKDHHG 107
                  689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2249104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.6E-2953105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.97955104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.6E-3055104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.1E-29185254IPR009057Homeodomain-like
SuperFamilySSF466898.84E-18185253IPR009057Homeodomain-like
TIGRFAMsTIGR015656.1E-29192248IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MAFTGEDKEM RMQGYNNSLE NSSNTTTTQV QEKARIPEPN SGGSKIKPAN PRFSYRECLK  60
NHAASIGGNV TDGCGEFMPS GEEGTLEALK CAACNCHRNF HRKDHHGESA LAGAAMVHPL  120
HLPPPLPSPS MSHHRVGVGG STGHWGPMLQ PVKMAFGSSG GGGGSAGTDS SSEELNFNSL  180
QVAPPPPQFS SKKRFRTKFT TEQKEKMMVF AEKLGWRIPR EDDSELQRFC AEVGVKRQVF  240
KVWMHNNKSN SSKKNPQEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-251912501675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-125PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S04e-64ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A068UH155e-95A0A068UH15_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000095817e-80(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.29e-55homeobox protein 31